Home Ajax Ajax Code Libraries and Tools



Ajax Code Libraries and Tools
Posted on: December 12, 2008 at 12:00 AM
Code libraries and loots for the development of your Ajax based applications.

Ajax Code Libraries and Tools 

     

Code libraries and loots for the development of your Ajax based applications. These days Ajax has been used for the development of responsive web application making it more user friendly. You can make your application's interface like gmail interface.

  1. Chickenfoot firebox  
    Chickenfoot is a Firefox extension that puts a programming environment in the browser's sidebar so you can write scripts to manipulate web pages and automate web browsing. In Chickenfoot, scripts are written in a superset of JavaScript that includes special functions specific to web tasks. Fixed some bugs related to packaging Chickenfoot scripts as standalone extensions. Exported Chickenfoot scripts were trying to find the chickenfoot/setup directory in the end-user?s Firefox profile directory. If the end-user had never installed Chickenfoot, this directory would not exist, causing the extension to crash.
       
  2. Mouse wheel programming in JavaScript
    Web applications are becoming more and more like ?normal? desktop applications. Of course, they are more and more functional, but smooth user interface acts the primary role. So we have drag and drop, autocompletition, and much more. Many of those nice features got possible only with help of AJAX. This page, however, is not about AJAX (or any other buzzword). It is about rather simple user input method -- mouse wheel. I believe it would now be difficult to find a mouse without wheel. Vast majority of users are used to the wheel as a control for scrolling in lists, zooming etc. Rather few web applications, however, make smart use of mouse wheel. This page is to provide you with general information about handling mouse wheel-generated events in JavaScript programming language.
       
  3. JavaScript Sound Kit
    The JavaScript Sound Kit is a wrapper around the ActionScript Sound Object, it makes it possible to use the Sound Object in JavaScript the same way you do it in ActionScript. The API works almost the same way as the ActionScript Sound Object. The JavaScript Sound Kit works by calling a Sound Object in a flash movie with a sound class bridge implemented. The magic happens by using the External Interface available on the flash plugin version 8.
       
  4. Hibernate, Spring, Echo2 Base Application
    This project is designed as a base application and guide for building AJAX applications using Hibernate, Spring, and Echo2. It is intentionally left sparse (It contains only a group and user editor) so that it can be used as a base for a full blown application. All three technologies are matched cohesively together to provide a robust base for your AJAX applications. Security:
    Allows username/password logon, logoff, and permission checking.
    Permissions can be queried using has Permission(), or enforced using require Permission().
    Enforcement is done in the business tier.
      
  5. XAP: Extensible AJAX Platform
    XAP is an XML-based declarative framework for building, deploying and maintaining rich, interactive Ajax powered web applications. It aims to reduce the need for scripting and help solve the development and maintenance challenges associated with large scale JavaScript programming. XAP provides:
    * Declarative rich user interface via XML; * Data binding for connecting UI to data. * Incremental update of web pages in a declaratively and programmatically. * A "plugin architecture" allowing developers to define their own XML tags to provide behavior and UI or even use a completely different XML syntax.
      
  6. Project jMaKi
    jMaki is all about enabling Java developers to use JavaScript in their Java based applications as either a JSP tag library or a JSF component. jMaki uses the best parts of Java and the best parts of JavaScript to deliver a rich AJAX style widgets. jMaki currently provides bootstrap widgets for many components from Dojo, Script.aculo.us, Yahoo UI Widgets, Spry, DHTML Goodies, and Google. jMaki provides a common interfaces to these widget libraries and allows you to use these libraries together in the same page. Play with the jMaki sample application running live at http://javaserver.org/jmaki. For more on running the code on your own server see Running the jMaki Sample Application.
       
  7. Protowidget
    I?d like to introduce a new JavaScript/Ajax framework that my company is creating. We?re calling it Protowidget because it uses Prototype and does things with widgets. And yes, we know it?s 2006 and this is something like the 800th Ajax framework released this year. We think this one is new and different, though (of course, every parent thinks their baby is beautiful). It is being created out of real needs while building applications for customers and is helping us create better stuff. Please note that this is just a preview. Not everything works like it should or has been tested to the degree we would like. In particular, under certain circumstances, the library leaks memory. We know what needs to change to fix this but haven?t gotten to it yet.
       
  8. WidgetServer
    In the beginning WidgetServer was intended to be an alternative to XML/GUI and XUL frameworks with the difference that WidgetServer supports multiple target technologies from one single binary application and configuration set:
    * Swing standalone applications or fat Clients,
    * Swing Client/Server application with a rich thin Swing Client,
    *Web applications based on HTML, CSS, if needed JavaScript,
    * and MulitChannel applications which support a mixed Client environment.
    * WidgetServer is prepared for other channels like SWT, mobile etc. 
         
  9. Rhino in Spring
    Rhino in Spring is a project that intends to integrate Mozilla Rhino JavaScript interpreter, the interpreter for the best (in our opinion) dynamic language on the Java platform with Spring Framework, the also best (again, in our opinion) enterprise framework on the Java platform. The aim is to provide a system that amalgamates the rapid development benefits and flexibility of a dynamic language with the strength, scalability and versatility of the Java platform and the Spring framework. At the moment, the project delivers a controller component for Spring MVC that allows complex control flows spanning several webpages in web applications to be expressed as a single structured algorithm in JavaScript, putting the rich set of control flow structures and function reusability of a full-blown language at your fingertips.
        
  10. Spry framework for Ajax
    The Spry framework for Ajax is a JavaScript library for web designers that provides functionality that allows designers to build pages that provide a richer experience for their users. It is designed to bring Ajax to the web design community who can benefit from Ajax, but are not well served by other frameworks. The first release of the Spry framework was a preview of the data capabilities that enable designers to incorporate XML data into their HTML documents using HTML, CSS, and a minimal amount of JavaScript, without the need for refreshing the entire page. The Spry framework is HTML-centric, and easy to implement for users with basic knowledge of HTML, CSS and JavaScript. The framework was designed such that the markup is simple and the JavaScript is minimal. The Spry framework can be used by anyone who is authoring for the web in their tool of choice. This is the 4th pre-release of Spry. In this release, we are introducing Spry Effects: JavaScript behaviors that provide animation and color effects for page elements.
          
  11. The Ajax Engine
    AJAX is a technology that enables web applications to call the webserver without leaving the actual page. It's possible to do this in the background without notice of the user. This avoids loading the same form or page including the html markup multiple times, reduces the network traffic and increases the user acceptance. The AJAX Engine that you can find here is built upon the webservice standard protocols SOAP and WSDL for transferring the data between the browser client and the web server instead of using a new or proprietary protocol.
    The key part of this engine is a small webservice client written in JavaScript and a state engine that controls the asynchronous communication. The benefit of that approach is that there is no need to invent new protocols and that the webservice framework on the server can be reused.
      
  12. The Dojo Foundation
    Dojo is Open Source software, distributed by a non-profit foundation which has been set up for the purpose of providing a vendor-neutral owner of Dojo intellectual property. The goals of all Foundation licensing decisions are to:
    * Encourage adoption
    * Discourage political contention
    * Encourage collaboration and integration with other projects
    * Be transparent
      
  13. What is JSMX?
    JSMX is an Ultra Lightweight - Language Agnostic - Ajax Framework. It is by far the easiest way to integrate Ajax into any Web Application. What separates JSMX from most other Ajax Frameworks is that the JSMX API runs entirely on the client and has no Server Side Components to install. Given this fact plus the fact that you can pass back JavaScript, XML, JSON, or WDDX makes JSMX a truly Universal Ajax API. Originally designed for ColdFusion developers by leveraging ColdFusion's native ability to quickly build server-side generated JavaScript it became (and still is) a very efficient choice as an Ajax API for the ColdFusion Community. But ColdFusion developers aren't the only ones who can take advantage of this small but powerful API. JSMX has been extended to support XML, JSON, and now WDDX while remaining completely backward compatible to it's original user base. With no Server Side Modules to install and with so many data-exchange options, JSMX is now the perfect choice for fast Ajax integration for ANY language.
            
  14. What is CFAjax?
    CFAjax is the AJAX implementation for coldfusion. It makes coldfusion method calls on server directly from HTML page using JavaScript and return backs the result to the calling HTML page. CFAjax comes with simple to use JavaScript API and simple coldfusion implementation that marshal?s the response between your CF methods and HTML page. Using CFAjax you can create highly interactive websites with greater performance and usability. Implementing authentication in CFAjax. If you are concerned about exposing your CFAjax logic/functions to outside world and want to prevent other websites from stealing/using your content, there are three authentication mechanism that you can implement in CFAjax to prevent unauthorized access.
      
  15. AjaxCFC
    AJAX is Asynchronous JavaScript and XML. It is not a technology, but an umbrella that combines several concepts to enrich user experience by allowing server interaction without refreshing the browser. AjaxCFC is a ColdFusion framework meant to speed up ajax application development and deployment by providing developers seamless integration between JavaScript and ColdFusion, and providing built-in functions, such as security and debugging, to quickly adapt to any type of environment and helping to overcome cross-browser compatibility problems.
        
  16. Ajason JavaScript
    AJASON is a PHP 5 library and JavaScript client for the upcoming Web technology called AJAX. AJAX permits data to be fetched asynchronously without the need for reloading the Web page and thus allows the development of interactive GUI-like Web applications. JSON is a lightweight data interchange format which is used by AJASON to exchange data between server and client. The key features of AJASON are:
    * Fully object oriented code in PHP 5 and JavaScript
    * Call PHP functions and object methods from JavaScript asynchronously
    * Exchange even complex data types like arrays and objects (precisely object properties) between server and client
    * Use JavaScript callback functions to process server responses
    * Client side error reporting for server side AJASON errors
    * Open source released under the GNU GPL 
      
  17. ICEfaces Ajax
    ICEfaces Community Edition is an Ajax application framework that enables J2EE application developers to easily create and deploy thin-client rich web applications in pure Java. ICEfaces Community Edition is a fully featured product that Java developers can use to develop new or existing J2EE applications at no cost. ICEfaces' revolutionary Direct-to-DOM (D2D) rendering technology and Ajax Bridge
    empowers developers to quickly produce sophisticated and robust J2EE applications that exhibit the following characteristics:
    * Smooth, incremental page updates with in-place editing and no full page refresh.
    * Asynchronous page updates driven from the application in real time.
    * Fine-grained user interaction during form entry that augments the standard submit/response loop.
    * User context preservation during page update, including scrollbar positioning and user focus.  
      
  18. Javeline Framework
    Javeline FrameWork does away with traditional page-based interfaces on the Internet. Web applications can now behave exactly like a desktop application. Javeline FrameWork includes familiar controls such as trees and buttons that enable developers to build interactive, data-bound applications that automatically update their data without round trips to the server. With the included Skinning Engine designers can create a custom look & feel, using familiar, established technology such as CSS and XHTML. Data is delivered to the application via Javeline TelePort, making Javeline FrameWork applications agnostic of back-end technology. Javeline TelePort takes care of the communication between the client and the server. It elegantly handles errors, time-outs and retry. TelePort features an advanced polling interface for controlling reconnecting and polling frequency. Javeline TelePort has built-in support for XML-RPC, SOAP, JSON, REST, Comet and Javeline FrameWork-specific protocols.
         
  19. My-BIC Ajax
    My-BIC provides support for XML, JSON and TEXT ajax transactions. My-BIC has also been tested to work with Safari, Firefox, IE and Opera web browsers. That's the front controller that runs the server side. I provide 2 server side pieces and you supply the rest. Please visit the tutorials section to see how easy most things are. The high level overview is you make a xmlhttp request to a server page named "mybic_server.php" which reads a $_REQUEST['action'] variable to find out what class it needs to load. The nice thing about having a front controller style on the server side is you can add security layers in one file which get handled on every ajax request. Let's say someone doesn't like you and decides to write a script that sends bad data nonstop to all your ajax pages. 
           
  20. Ajax Toolkit Frameworks
    AJAX Toolkit Framework (ATF) provides extensible tools for building IDEs for the many different AJAX (asynchronous JavaScript and XML) run-time environments (such as Dojo, Zimbra, etc.). This technology also contains features for developing, debugging, and testing AJAX applications. The framework provides enhanced JavaScript editing features such as edit-time syntax checking; an embedded Mozilla Web browser; an embedded DOM browser; and an embedded JavaScript debugger. An additional and unique aspect of the framework is the Personality Builder function, which assists in the construction of IDE features for arbitrary AJAX run-time frameworks and thus adds to the supported set of run-time environments in the ATF. 
           
  21. SAJAX Simple Ajax Toolkit
    Get support from the people who made Ajax easy for the masses. If your staff needs a helping hand with your Ajax project, we now offer commercial support and consulting. Email support for the Sajax library starts at an affordable $199 per year. We can help you build your project for rates from $150 per hour. Contact us for more information. Sajax itself remains under the open source BSD license. Sajax is an open source tool to make programming websites using the Ajax framework - also known as XMLHTTPRequest or remote scripting  as easy as possible. Sajax makes it easy to call PHP, Perl or Python functions from your webpages via JavaScript without performing a browser refresh. The toolkit does 99% of the work for you so you have no excuse to not use it.
       
  22. Get Elements By Tag Names
    HTML has several related elements with distinct tag names, like h1-h6 or input, select and textarea. getElementsByTagName works only on elements with the same tag name, so you cannot use it to get a list of all headers or all form fields. The getElementsByTagNames script (note the plural "names") takes a list of tag names and returns an array that contains all elements with these tag names in the order they appear in the source code. This is extremely useful for, for instance, my ToC script, which needs all h3s and h4s in the document in the correct order. I'd have  loved to add this method to the Node prototype, but that's impossible in Explorer and Safari. Therefore I use it as a normal function until all browsers expose their W3C DOM prototypes. 
         
  23. JavaScript Component for AJAX
    AJAX Client Engine (ACE) is a JavaScript component that makes it easy to develop AJAX-style Web applications.
    * Object-oriented API. The component encapsulates the details of creating and calling the XMLHTTPRequest object completely. It provides an object-oriented API that is simple and yet powerful. The user only need become familiar with three JavaScript classes, Engine, Request, and Response, to access all the functionality of the XMLHTTPRequest object as well as additional framework services.
    * Cross-browser support. The component handles the differences between Internet Explorer and Mozilla Firefox browsers in creating the XMLHTTPRequest object, transforming XML documents, and so on.
    * Request option. The user can make either an asynchronous or a synchronous request by either providing a callback function or not.
        
  24. Rialto - Rich Internet Application Toolkit
    Rialto (Rich Internet Application Toolkit) is ajax-based cross browser JavaScript widgets library. Because it is technology agnostic it can be encapsulated in JSP, JSF, .Net, Python or PHP graphic components. Nowadays it supports pure JavaScript development and JSP/taglib development. A JSF, pyhton, .Net and PHP integration are on the road. The purpose of Rialto is to ease the access to rich internet application development to corporate developers. Ideally a Rialto developer have neither need to write or understand DHTML, Ajax or DOM code.
       
  25. PAJAJ: PHP Asynchronous JavaScript and JSON
    You do not have to be an expert at PHP, HTML, JavaScript, and CSS to use the framework. You can do most, if not all, your coding in PHP, and the framework will generate HTML, CSS, and JavaScript for you. There are object for most of the HTML element, with method to manage common task, like updating the content of a Div or items in a forms Select pull down. A lot of the other frames include a simple example that is anything but simple. the framework supports 3 different development models: i. the developer develops the whole application and interface in PHP, since the framework knows about HTML elements you want to interact with, i.e. there are objects for Select, Div, Table with instances with unique IDs; it is easy to have the framework generate simple html and CSS for you. ii. A designer generate a pretty but dump page, and you then hook events to it to make it a real application.  iii. You design an interface as a template, and have the framework make html, CSS, JavaScript that you pore into the template.
      
  26. Ajax jsquery
    An implementation of an AJAX JavaScript data generation server, http client, and client result set Uses a JavaScript http client to dynamically map the results of data requests from a Java application server to a web browser HTML form without requiring refresh or page submit (similar to Google Suggest). Server side data can be SQL via JDBC, an object relational mapping using a tool such as Hibernate, returned from a server connecting a group of peers or pipelined from another source like a SOAP server. In other words, jsquery allows the pages in your web application to dynamically get new information from the a server application without requiring a page refresh. 
       
  27. Sack Ajax JavaScript
    SACK and will be, over the next little while, updated with resources and tutorials about how to use SACK to enhance your webpages. Maybe it will even give you some ideas! If you come up with something special please let me know, I?d love to hear from people that are using my SACK in their projects or products. The same goes for any suggestions, please tell me how I can make this better. SACK 1.2 is included with WordPress 2.0, which makes me happy beyond words, newer versions of SACK should work with no problems in WordPress. Full documentation of the classes methods and variables is available here. However this information is included in the zip package as well. It should be more than you need, but if you have any trouble then please let me know: The aim is to make everything simple, so if you are confused I need to fix something.  
       
  28. JS Eclipse
    JSEclipse is the best and most popular JavaScript plugin for the Eclipse environment. Its benefits are visible from the simplest tasks like editing small sections of code for your site to the more complex ones like working with the next big AJAX library or developing plugins for a product that embeds JavaScript like Dreamweaver or Photoshop. JSEclipse offers several licensing options, out of which one will surely fit your needs. Read more about the licensing scheme. You can also use the unrestricted free for non-commercial use version.
        
  29. Ajax any where
    Ajax Anywhere is designed to turn any set of existing JSP or JSF components into AJAX-aware components without complex JavaScript coding. In contrast to other solutions, Ajax Anywhere is not component-oriented. You will not find here yet another AutoComplete component. Simply separate your web page into multiple zones, and use Ajax Anywhere to refresh only those zones that needs to be updated.
    How to work: 1. Mark "reload-capable" zones of a web page with AjaxAnywhere custom tags. 2. Instead of submitting a form in traditional way, do it by AjaxAnywhere javascript API. 3. During request processing on the server-side, determine the zones to refresh.  4. On the server-side AjaxAnywhere will generate an XML containing only the "updated" HTML. 5. On the client-side AjaxAnywhere javascript will receive the XML, parse it and update the selected zones.
       
  30. PowerWEB LiveControls for ASP.NET
    Imagine creating rich web applications that don't flash when posting data to the server...shopping carts that dynamically confirm customer information, inventory, shipping costs, and discounts using server-side resources...financial applications that update rates without the usual flicker...sports applications that update scores in real time...all with simple drag and drop ASP.NET controls. PowerWEB LiveControls for ASP.NET is a suite of 21 Web Controls that allow you to raise server-side callbacks and update form elements without reloading the entire HTML page. They are a direct replacement for many standard Microsoft controls, allowing you to manipulate client-side objects or send data to the client without disrupting the user experience with a page refresh.
       
  31. World's Easiest JavaScript AJAX ToolKit
    AJFORM is a JavaScript toolkit which simply submits data from any given form in an HTML page, then sends the data to any specified JavaScript function. AJFORM degrades gracefully in every aspect. In other words, if the browser doesn't support it, the data will be sent through the form as normal. It has been successfully tested on: * Mozilla FireFox 1.0+  * Netscape 7.0+  * Internet Explorer 5.5+ for Windows * Safari 1.2+  * Opera 7.6+ .
      
  32. Ajax JSP Tag Library
    The AJAX Tag Library is a set of JSP tags that simplify the use of Asynchronous JavaScript and XML (AJAX) technology in JavaServer Pages. AJAX is primarily rooted in JavaScript. However, many server-side developers do not have an extensive knowledge of client-side programming in the browser. It's much easier in some cases for J2EE developers, especially, to simply add a JSP tag to the page to gain the function desired. This tag library fills that need by not forcing J2EE developers to write the necessary JavaScript to implement an AJAX-capable web form. The tag library provides support for live form updates for the following use cases: auto complete based on character input to an input field, select box population based on selections made from another field, callout or balloon popup for highlighting content, refreshing form fields, and toggling images and form field states on/off.
       
  33. JavaScript to Java AJAX communications library
    JSON-RPC-Java is a key piece of Java web application middleware that allows JavaScript DHTML web applications to call remote methods in a Java Application Server without the need for page reloading (now refered to as AJAX). It enables a new breed of fast and highly dynamic enterprise Web 2.0 applications. JSON-RPC-Java is a dynamic JSON-RPC implementation in Java. It allows you to transparently call server-side Java code from JavaScript with an included lightweight JSON-RPC JavaScript client. It is designed to run in a Servlet container such as Tomcat and can be used with JBoss and other J2EE Application servers to allow calling of plain Java or EJB methods from within a JavaScript DHTML web application.
      
  34. Introduction to JSON
    JavaScript Object Notation (JSON) is a lightweight data-interchange format. It is easy for humans to read and write. It is easy for machines to parse and generate. It is based on a subset of the JavaScript Programming Language, Standard ECMA-262 3rd Edition - December 1999. JSON is a text format that is completely language independent but uses conventions that are familiar to programmers of the C-family of languages, including C, C++, C#, Java, JavaScript, Perl, Python, and many others. These properties make JSON an ideal data-interchange language. JSON is built on two structures:
    * A collection of name/value pairs. In various languages, this is realized as an object, record, struct, dictionary, hash table, keyed list, or associative array.
    * An ordered list of values. In most languages, this is realized as an array, vector, list, or sequence.
        
  35. Introduction to the Simple Web Framework
    The Simple Web Framework (SWF) is a Java framework for creating Web applications and occupies the same architectural niche as Struts and JSF. Unlike Struts and similar to JSF, the SWF is based on a server side event system. Unlike Struts or JSF, the SWF supports In place Page Updating, or IPU. With IPU, an event is posted through an XmlHttpRequest channel rather than as a form submit, as is the case with JSF. The result returned to the browser is not a full page, but only the page fragments that have been changed (dirty regions) by the event. The SWF refreshes the dirty fragments in place, without reloading the page. With IPU, the page will not lose its scroll position, JavaScript variables will not be lost, and a host of other behavioral improvements that help you create a richer application. The SWF also fully supports links and submit type events, like JSF, for when you want (or need) to use full Page reloads.
       
  36. AjaxAC - Open-souce PHP framework for AJAX
    AjaxAC is an open-source framework written in PHP, used to develop/create/generate AJAX applications. The fundamental idea behind AJAX (Asynchronous JavaScript And XML) is to use the XMLHttpRequest object to change a web page state using background HTTP sub-requests without reloading the entire page. It is released under the terms of the Apache License v2.0. Features 
    The basic idea behind AjaxAC is that you create an AjaxAC application, which in itself contains a number of action handlers and event handlers. An application in this context might mean an entire web site powered by AJAX, or it could mean a subset of a form.
    * All application code is self-contained in a single class (plus any additional JavaScript libraries)
    * Calling PHP file / HTML page is very clean. All that is required is creating of the application class, then referencing the application JavaScript and attaching any required HTML elements to the application.
    * Built in functionality for easily handling JavaScript events.
      
  37. Flexible Ajax Framework
    Flexible Ajax is a handler to combine the remote scripting technology, also known as AJAX (Asynchronous Javascript and XML), with a php-based backend. The AJAX Technique is best described in the wikipedia article and the original article on adaptivepath.com, giving the technique the name AJAX. Basically, Flexible Ajax is the tool to call php functions from within javascript and handle the returned values, without having to reload the entire page. Facts about Flexible Ajax
    * written in PHP5 using object-oriented code
    * consists of a client and a server handler
    * allows separation of client side-code and server side-code
    * get and post methods supported
    * easy to implement into existing co
      
  38. Introducting xajax 0.2.4
    xajax is an open source PHP class library that allows you to easily create powerful, web-based, Ajax applications using HTML, CSS, JavaScript, and PHP. Applications developed with xajax can asynchronously call server-side PHP functions and update content without reloading the page. The xajax PHP object generates JavaScript wrapper functions for the PHP functions you want to be able to call asynchronously from your application. When called, these wrapper functions use JavaScript's XMLHttpRequest object to asynchronously communicate with the xajax object on the server which calls the corresponding PHP functions. Upon completion, an xajax XML response is returned from the PHP functions, which xajax passes back to the application. The XML response contains instructions and data that are parsed by xajax's JavaScript message pump and used to update the content of your application.
      

Related Tags for Ajax Code Libraries and Tools :
cajaxwebdevelopmentapplicationiousersedapplicationsooappforiefriendbaseeitaxlibliusedevinrarlibrariesasfriendlymntcajbasedesendasemeppdaycatsspeeespdaysatkhaivdevelopandarcodcodessrithatiaplibrarieicaicaplndodeono


More Tutorials from this section

Ask Questions?    Discuss: Ajax Code Libraries and Tools   View All Comments

Post your Comment


Your Name (*) :
Your Email :
Subject (*):
Your Comment (*):
  Reload Image
 
 

Ask Questions?

If you are facing any programming issue, such as compilation errors or not able to find the code you are looking for.

Ask your questions, our development team will try to give answers to your questions.